PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco017897.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WOX
Protein Properties Length: 253aa    MW: 27280.3 Da    PI: 6.9472
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco017897.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.61.4e-152686257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  Aco017897.1 26 RTRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLekfgAVGDANVFYWFQNRRSRSRR 86
                 89*****************99*************************************997 PP

2Wus_type_Homeobox108.24.8e-352588265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +rtRWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G+++d+NVfyWFQNr++R+r++q
        Aco017897.1 25 VRTRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGAVGDANVFYWFQNRRSRSRRRQ 88
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.45E-141793IPR009057Homeodomain-like
PROSITE profilePS5007111.2242287IPR001356Homeobox domain
SMARTSM003891.1E-62491IPR001356Homeobox domain
PfamPF000463.4E-132686IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-82691IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MDDENTTSKN PIHDGSPPDR PAEPVRTRWT PKPEQILILE SIFNSGMVNP PKDETVRIRK  60
LLEKFGAVGD ANVFYWFQNR RSRSRRRQRQ MQAGLLNDPV AGSGSSSSSS SSSRSLSSGG  120
FFASSSSSSS SSSSSNSCSS SSFIGDDCSS SDDLFAISRQ MGFVESNRFA PAFVGASSDV  180
TSQLHYQAGT ITVFINGIAS EVPRGPIDLR TMFGQGVMLV HSSGDLLPVN EYGILMHSLQ  240
MGESYFLVPR PT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008781305.15e-88PREDICTED: WUSCHEL-related homeobox 6-like isoform X1
RefseqXP_008781307.15e-88PREDICTED: WUSCHEL-related homeobox 6-like isoform X2
SwissprotQ0D3I76e-79WOX11_ORYSJ; WUSCHEL-related homeobox 11
TrEMBLM0SD632e-81M0SD63_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P09460_0017e-81(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107837109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.19e-37WUSCHEL related homeobox 11